PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.23794s0459.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 315aa    MW: 35806.8 Da    PI: 4.4128
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.23794s0459.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573109.52.4e-3453147397
                DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                           +++ ws++De+v+L G++d++++t+ s+ +d+dafy+++k+s+++ +sk+ql++K+++LK+Kf+ +++++++gke sf+ ++d++if+l
  Bostr.23794s0459.1.p  53 SKMNWSKNDELVILGGIVDYENETELSYRSDWDAFYRYIKGSVEASFSKKQLIDKVKHLKRKFTYNQARSNDGKELSFTDTDDDEIFKL 141
                           7899************************************************************************************* PP

                DUF573  92 skkiWg 97 
                           s++iW 
  Bostr.23794s0459.1.p 142 SMRIWA 147
                           *****6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.1E-2655146IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MVATKRLGNY SGSNSDDSLT RNGDDGVEAM LRKRKQRKTT TTTTTTLVPS SASKMNWSKN  60
DELVILGGIV DYENETELSY RSDWDAFYRY IKGSVEASFS KKQLIDKVKH LKRKFTYNQA  120
RSNDGKELSF TDTDDDEIFK LSMRIWANNE DMDQAKDVPC AEQESKENKD VLCAEQEDKD  180
VPCAEQERVS IEIDNGEKEK SEEDGVEELY VQEETLESGI SFQNLGKNGE KEKSEEDGVD  240
ELGVLQEILE ADTFFQNLGS RYQQKLMLKN LENVGVERRK ELIDEWKALC AEEMQLFIKK  300
LTFFAKLANG GVSP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010516846.11e-136PREDICTED: uncharacterized protein LOC104792409
TrEMBLR0FWQ61e-133R0FWQ6_9BRAS; Uncharacterized protein
STRINGAT2G36340.11e-116(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124401528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36340.11e-127DNA-binding storekeeper protein-related transcriptional regulator